PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462898003
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MYB
Protein Properties Length: 158aa    MW: 18451.7 Da    PI: 10.9016
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462898003genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.42.9e-121670148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.......TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.......kgRtlkqcksrwqkyl 48
                     +g W++eEde+l   ++++G  tW++  +++        ++R++k+c++rw +yl
        462898003 16 KGLWSPEEDERLFTQITRHGVSTWSSLINCLFlnvvkagLRRSGKSCRLRWMNYL 70
                     678***********************99999999*******************97 PP

2Myb_DNA-binding44.53.7e-1478119346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      + ++ E+e ++ + + lG++ W+tIa+ m+ gRt++++k++w++
        462898003  78 PISKREEEVIISLQQSLGNR-WSTIAASMP-GRTDNEIKNYWNS 119
                      56889***************.*********.***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5009010.2321170IPR017877Myb-like domain
SMARTSM007173.7E-91572IPR001005SANT/Myb domain
SuperFamilySSF466897.11E-2715117IPR009057Homeodomain-like
PfamPF002491.7E-91670IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-181777IPR009057Homeodomain-like
CDDcd001671.40E-61970No hitNo description
PROSITE profilePS5129421.08271125IPR017930Myb domain
SMARTSM007175.1E-1275123IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.1E-2478125IPR009057Homeodomain-like
PfamPF002491.7E-1178119IPR001005SANT/Myb domain
CDDcd001675.85E-878118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MVRKPSHADG ESKERKGLWS PEEDERLFTQ ITRHGVSTWS SLINCLFLNV VKAGLRRSGK  60
SCRLRWMNYL RPDLKKEPIS KREEEVIISL QQSLGNRWST IAASMPGRTD NEIKNYWNSR  120
IRKRLNAAAK XXXXXXXXXX IIRSYTNILA RSNVEAWY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-251612527128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9715591e-80EU971559.1 Zea mays clone 367166 anthocyanin regulatory C1 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968332.17e-69PREDICTED: transcription factor MYB82-like
SwissprotP200271e-46MYB3_HORVU; Myb-related protein Hv33
TrEMBLK3XL228e-69K3XL22_SETIT; Uncharacterized protein
STRINGSi002595m2e-68(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.12e-44myb domain protein 86